PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.008G055700.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 261aa    MW: 28588.9 Da    PI: 9.0372
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.008G055700.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.55.6e-1755102148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                           +g+WT++Ed++lv ++k +G g+W++ ++  g+ R++k+c++rw +yl
  Sobic.008G055700.3.p  55 KGAWTKDEDQRLVAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINYL 102
                           79******************************99************97 PP

2Myb_DNA-binding53.84.3e-17108152147
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                           rg++T eEdel+++ + +lG++ W++Ia +++ gRt++++k++w+++
  Sobic.008G055700.3.p 108 RGNFTHEEDELIIRFHGLLGNK-WSLIAGRLP-GRTDNEIKNYWNTH 152
                           89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.3E-2346105IPR009057Homeodomain-like
PROSITE profilePS5129416.33150102IPR017930Myb domain
SMARTSM007174.9E-1354104IPR001005SANT/Myb domain
SuperFamilySSF466895.75E-2954149IPR009057Homeodomain-like
PfamPF002498.8E-1555102IPR001005SANT/Myb domain
CDDcd001671.88E-1057102No hitNo description
PROSITE profilePS5129426.895103157IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.4E-27106158IPR009057Homeodomain-like
SMARTSM007176.3E-16107155IPR001005SANT/Myb domain
PfamPF002492.5E-15108152IPR001005SANT/Myb domain
CDDcd001679.09E-12110153No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
FLSPPHINLR PLSLYSTLTT NIVTTRQVPA VLRSNDEEDS DKGRSPCCEK AHTNKGAWTK  60
DEDQRLVAYI KAHGEGCWRS LPKAAGLLRC GKSCRLRWIN YLRPDLKRGN FTHEEDELII  120
RFHGLLGNKW SLIAGRLPGR TDNEIKNYWN THIKRNLIAR GIDPKTHRPL GVSTSAAAAS  180
SHRRQDQDHL LSARSSCSPE TSGDDDSASA PYDGGGIDLN LSISPPRQPP SPSPPPTRQE  240
AEATSGEVLG DANGSKKNST *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-28551577108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM1569051e-151AM156905.1 Zea mays mRNA for transcription factor MYB8 (myb8 gene).
GenBankEU9639111e-151EU963911.1 Zea mays clone 274019 hypothetical protein mRNA, complete cds.
GenBankHQ8586921e-151HQ858692.1 Zea mays clone UT1148 ZmMYB8 transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004977237.11e-104PREDICTED: myb-related protein Zm38-like
SwissprotP813931e-87MYB08_ANTMA; Myb-related protein 308
SwissprotQ9SZP17e-87MYB4_ARATH; Transcription repressor MYB4
TrEMBLK3YCR71e-104K3YCR7_SETIT; Uncharacterized protein
STRINGSi012017m1e-103(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.14e-87myb domain protein 4